Lineage for d2gfbl2 (2gfb L:120-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655776Domain d2gfbl2: 2gfb L:120-227 [21057]
    Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb1, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbo1, d2gfbo2, d2gfbp1

Details for d2gfbl2

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity
PDB Compounds: (L:) igg2a cnj206 fab (heavy chain)

SCOP Domain Sequences for d2gfbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbl2 b.1.1.2 (L:120-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d2gfbl2:

Click to download the PDB-style file with coordinates for d2gfbl2.
(The format of our PDB-style files is described here.)

Timeline for d2gfbl2: