Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d2gfbl2: 2gfb L:120-227 [21057] Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb1, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbo1, d2gfbo2, d2gfbp1 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbl2 b.1.1.2 (L:120-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d2gfbl2:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |