SCOPe 2.06: Domain d3gkwl2: 3gkw L:108-207

Lineage for d3gkwl2 (3gkw L:108-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3gkwl2: 3gkw L:108-207 [210569]
   Other proteins in same PDB: d3gkwl1
   automated match to d1rhha2
   complexed with 1pe, peg

Details for d3gkwl2

PDB Entry: 3gkw, 2.5 Å

PDB Description: crystal structure of the fab fragment of nimotuzumab. an anti- epidermal growth factor receptor antibody

PDB Compounds: (L:) Light chain of the antibody Nimotuzumab

SCOPe Domain Sequences for d3gkwl2:

Sequence, based on SEQRES records:

>d3gkwl2 b.1.1.2 (L:108-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
revaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtk

Sequence, based on observed residues (ATOM records):

>d3gkwl2 b.1.1.2 (L:108-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
revaapsvfifppsdeqlksgtasvvcllnnfypreakvqwqsgnsqesvteqdskdsty
slsstltlskadycevthqglsspvtk

Timeline for d3gkwl2:

• d3gkwl2 first appeared in SCOPe 2.03
  
• d3gkwl2 appears in SCOPe 2.05
  
• d3gkwl2 appears in SCOPe 2.07
  
• d3gkwl2 appears in the current release, SCOPe 2.08