Lineage for d3gjwa1 (3gjw A:1-135)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998271Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1998272Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1998273Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 1998274Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 1998283Species Human (Homo sapiens) [TaxId:9606] [101198] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 1998284Domain d3gjwa1: 3gjw A:1-135 [210550]
    Other proteins in same PDB: d3gjwa2
    automated match to d1gs0a1
    protein/DNA complex; complexed with gjw

Details for d3gjwa1

PDB Entry: 3gjw (more details), 2.3 Å

PDB Description: parp complexed with a968427
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d3gjwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gjwa1 a.41.1.1 (A:1-135) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d3gjwa1:

Click to download the PDB-style file with coordinates for d3gjwa1.
(The format of our PDB-style files is described here.)

Timeline for d3gjwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gjwa2