SCOPe 2.03: Domain d2gfbi2: 2gfb I:109-214

Lineage for d2gfbi2 (2gfb I:109-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (364 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d2gfbi2: 2gfb I:109-214 [21054]
   Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbp1, d2gfbp2
   part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region

Details for d2gfbi2

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

PDB Compounds: (I:) igg2a cnj206 fab (light chain)

SCOPe Domain Sequences for d2gfbi2:

Sequence; same for both SEQRES and ATOM records:

>d2gfbi2 b.1.1.2 (I:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2gfbi2:

• d2gfbi2 first appeared (with stable ids) in SCOP 1.55
  
• d2gfbi2 appears in SCOPe 2.02
  
• d2gfbi2 appears in SCOPe 2.04
  
• d2gfbi2 appears in the current release, SCOPe 2.08