Lineage for d3gg5b_ (3gg5 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972632Species Human (Homo sapiens) [TaxId:9606] [189245] (10 PDB entries)
  8. 2972650Domain d3gg5b_: 3gg5 B: [210524]
    automated match to d2aaza_
    complexed with po4, so4

Details for d3gg5b_

PDB Entry: 3gg5 (more details), 2.77 Å

PDB Description: replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d3gg5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg5b_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d3gg5b_:

Click to download the PDB-style file with coordinates for d3gg5b_.
(The format of our PDB-style files is described here.)

Timeline for d3gg5b_: