Lineage for d3gema_ (3gem A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351004Species Pseudomonas syringae [TaxId:264730] [225625] (1 PDB entry)
  8. 1351005Domain d3gema_: 3gem A: [210511]
    automated match to d2c07a1
    complexed with act

Details for d3gema_

PDB Entry: 3gem (more details), 1.83 Å

PDB Description: crystal structure of short-chain dehydrogenase from pseudomonas syringae
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d3gema_:

Sequence, based on SEQRES records: (download)

>d3gema_ c.2.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 264730]}
sapilitgasqrvglhcalrllehghrviisyrtehasvtelrqagavalygdfscetgi
mafidllktqtsslravvhnasewlaetpgeeadnftrmfsvhmlapylinlhcepllta
sevadivhisddvtrkgsskhiaycatkaglesltlsfaarfaplvkvngiapallmfqp
kddaayranalaksalgiepgaeviyqslrylldstyvtgttltvnggrhvk

Sequence, based on observed residues (ATOM records): (download)

>d3gema_ c.2.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 264730]}
sapilitgasqrvglhcalrllehghrviisyrtehasvtelrqagavalygdfscetgi
mafidllktqtsslravvhnasewlaetpgeeadnftrmfsvhmlapylinlhcepllta
sevadivhisddvtrkgsskhiaycatkaglesltlsfaarfaplvkvngiapallmfsa
lgiepgaeviyqslrylldstyvtgttltvnggrhvk

SCOPe Domain Coordinates for d3gema_:

Click to download the PDB-style file with coordinates for d3gema_.
(The format of our PDB-style files is described here.)

Timeline for d3gema_: