Lineage for d2gfbc2 (2gfb C:109-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550213Domain d2gfbc2: 2gfb C:109-214 [21048]
    Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbp1, d2gfbp2

Details for d2gfbc2

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbc2 b.1.1.2 (C:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2gfbc2:

Click to download the PDB-style file with coordinates for d2gfbc2.
(The format of our PDB-style files is described here.)

Timeline for d2gfbc2: