SCOPe 2.05: Domain d3gbea1: 3gbe A:16-493

Lineage for d3gbea1 (3gbe A:16-493)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Protaminobacter rubrum [TaxId:126825] [225680] (2 PDB entries)

8. Domain d3gbea1: 3gbe A:16-493 [210477]
   Other proteins in same PDB: d3gbea2
   automated match to d1m53a2
   complexed with edo, flc, noj

Details for d3gbea1

PDB Entry: 3gbe, 1.7 Å

PDB Description: Crystal structure of the isomaltulose synthase SmuA from Protaminobacter rubrum in complex with the inhibitor deoxynojirimycin

PDB Compounds: (A:) Sucrose isomerase SmuA from Protaminobacter rubrum

SCOPe Domain Sequences for d3gbea1:

Sequence; same for both SEQRES and ATOM records:

>d3gbea1 c.1.8.1 (A:16-493) automated matches {Protaminobacter rubrum [TaxId: 126825]}
tipkwwkeavfyqvyprsfkdtngdgigdingiiekldylkalgidaiwinphydspntd
ngydirdyrkimkeygtmedfdrlisemkkrnmrlmidvvinhtsdqnewfvksksskdn
pyrgyyfwkdakegqapnnypsffggsawqkdektnqyylhyfakqqpdlnwdnpkvrqd
lyamlrfwldkgvsglrfdtvatyskipdfpnltqqqlknfaaeytkgpnihryvnemnk
evlshydiatageifgvpldqsikffdrrrdelniaftfdlirldrdsdqrwrrkdwkls
qfrqiidnvdrtageygwnaffldnhdnpravshfgddrpqwrepsakalatltltqrat
pfiyqgselgmtnypfkaidefddievkgfwhdyvetgkvkadeflqnvrltsrdnsrtp
fqwdgsknagftsgkpwfkvnpnyqeinavsqvtqpdsvfnyyrqlikirhdipalty

Timeline for d3gbea1:

• d3gbea1 first appeared in SCOPe 2.03
  
• d3gbea1 appears in SCOPe 2.04
  
• d3gbea1 appears in SCOPe 2.06
  
• d3gbea1 appears in the current release, SCOPe 2.08