SCOPe 2.04: Domain d3gb7c_: 3gb7 C:

Lineage for d3gb7c_ (3gb7 C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)

8. Domain d3gb7c_: 3gb7 C: [210465]
   Other proteins in same PDB: d3gb7a1, d3gb7a2, d3gb7b1, d3gb7b2
   automated match to d1r3jc_
   complexed with dga, ni

Details for d3gb7c_

PDB Entry: 3gb7, 2.85 Å

PDB Description: potassium channel kcsa-fab complex in li+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3gb7c_:

Sequence; same for both SEQRES and ATOM records:

>d3gb7c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d3gb7c_:

• d3gb7c_ first appeared in SCOPe 2.03
  
• d3gb7c_ appears in SCOPe 2.05
  
• d3gb7c_ appears in the current release, SCOPe 2.08