SCOP 1.69: Domain d2gfba2: 2gfb A:109-214

Lineage for d2gfba2 (2gfb A:109-214)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d2gfba2: 2gfb A:109-214 [21046]
   Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbp1, d2gfbp2

Details for d2gfba2

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfba2:

Sequence; same for both SEQRES and ATOM records:

>d2gfba2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2gfba2:

• d2gfba2 first appeared (with stable ids) in SCOP 1.55
  
• d2gfba2 appears in SCOP 1.67
  
• d2gfba2 appears in SCOP 1.71
  
• d2gfba2 appears in the current release, SCOPe 2.08