Lineage for d3g83b2 (3g83 B:205-234)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2590059Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2590060Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2590132Protein Surfactant protein [57949] (3 species)
  7. 2590133Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 2590189Domain d3g83b2: 3g83 B:205-234 [210448]
    Other proteins in same PDB: d3g83a1, d3g83b1, d3g83c1
    complexed with ca, man

Details for d3g83b2

PDB Entry: 3g83 (more details), 1.9 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with alpha 1,2 dimannose.
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3g83b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g83b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d3g83b2:

Click to download the PDB-style file with coordinates for d3g83b2.
(The format of our PDB-style files is described here.)

Timeline for d3g83b2: