Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries) |
Domain d3g83a1: 3g83 A:235-355 [210445] Other proteins in same PDB: d3g83a2, d3g83b2, d3g83c2 complexed with ca |
PDB Entry: 3g83 (more details), 1.9 Å
SCOPe Domain Sequences for d3g83a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g83a1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d3g83a1:
View in 3D Domains from other chains: (mouse over for more information) d3g83b1, d3g83b2, d3g83c1, d3g83c2 |