SCOP 1.55: Domain d1ncch2: 1ncc H:114-227

Lineage for d1ncch2 (1ncc H:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab NC41 (mouse), kappa L chain [49010] (4 PDB entries)

8. Domain d1ncch2: 1ncc H:114-227 [21043]
   Other proteins in same PDB: d1ncch1, d1nccl1, d1nccn_

Details for d1ncch2

PDB Entry: 1ncc, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncch2:

Sequence; same for both SEQRES and ATOM records:

>d1ncch2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

Timeline for d1ncch2:

• d1ncch2 appears in SCOP 1.57
  
• d1ncch2 appears in the current release, SCOPe 2.08