Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class delta GST [81355] (6 species) formerly a part of class theta enzymes |
Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries) |
Domain d3g7ia2: 3g7i A:91-217 [210424] Other proteins in same PDB: d3g7ia1, d3g7ib1 automated match to d1jlwa1 complexed with gsh |
PDB Entry: 3g7i (more details), 2.05 Å
SCOPe Domain Sequences for d3g7ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7ia2 a.45.1.1 (A:91-217) Class delta GST {Anopheles dirus [TaxId: 7168]} sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak vfgryft
Timeline for d3g7ia2: