Lineage for d3g5xc1 (3g5x C:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744532Domain d3g5xc1: 3g5x C:1-107 [210411]
    Other proteins in same PDB: d3g5xa2, d3g5xc2
    automated match to d1c12a1

Details for d3g5xc1

PDB Entry: 3g5x (more details), 2.3 Å

PDB Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR
PDB Compounds: (C:) 806 light chain

SCOPe Domain Sequences for d3g5xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5xc1 b.1.1.1 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchssqdinsnigwlqqkpgksfkgliyhgtnlddevps
rfsgsgsgadysltisslesedfadyycvqyaqfpwtfgggtkleik

SCOPe Domain Coordinates for d3g5xc1:

Click to download the PDB-style file with coordinates for d3g5xc1.
(The format of our PDB-style files is described here.)

Timeline for d3g5xc1: