Lineage for d1ncdh2 (1ncd H:114-227)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104331Species Fab NC41 (mouse), kappa L chain [49010] (4 PDB entries)
  8. 104338Domain d1ncdh2: 1ncd H:114-227 [21041]
    Other proteins in same PDB: d1ncdh1, d1ncdl1, d1ncdn_

Details for d1ncdh2

PDB Entry: 1ncd (more details), 2.9 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncdh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncdh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d1ncdh2:

Click to download the PDB-style file with coordinates for d1ncdh2.
(The format of our PDB-style files is described here.)

Timeline for d1ncdh2: