Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab NC41 (mouse), kappa L chain [49010] (4 PDB entries) |
Domain d1ncah2: 1nca H:114-227 [21039] Other proteins in same PDB: d1ncah1, d1ncal1, d1ncan_ complexed with ca, man, nag |
PDB Entry: 1nca (more details), 2.5 Å
SCOP Domain Sequences for d1ncah2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncah2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab NC41 (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d1ncah2: