Lineage for d3g5ga_ (3g5g A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268494Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1268495Protein automated matches [190907] (3 species)
    not a true protein
  7. 1268496Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries)
  8. 1268523Domain d3g5ga_: 3g5g A: [210383]
    automated match to d4f8da_

Details for d3g5ga_

PDB Entry: 3g5g (more details), 2.8 Å

PDB Description: Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d3g5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5ga_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilk

SCOPe Domain Coordinates for d3g5ga_:

Click to download the PDB-style file with coordinates for d3g5ga_.
(The format of our PDB-style files is described here.)

Timeline for d3g5ga_: