Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225619] (9 PDB entries) |
Domain d3g5da_: 3g5d A: [210381] automated match to d2gqgb_ complexed with 1n1, gol |
PDB Entry: 3g5d (more details), 2.2 Å
SCOPe Domain Sequences for d3g5da_:
Sequence, based on SEQRES records: (download)
>d3g5da_ d.144.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc qcwrkdpeerptfeylqafledyftstepqyqpgenl
>d3g5da_ d.144.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgevwmgtwngttrvaiktlspeaflqeaqvmkklrheklvq lyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvh rdlraanilvgenlvckvadfglarlfpikwtapeaalygrftiksdvwsfgillteltt kgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafle dyftstepqyqpgenl
Timeline for d3g5da_: