SCOP 1.61: Domain d1ncbl2: 1ncb L:109-214

Lineage for d1ncbl2 (1ncb L:109-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab NC41 (mouse), kappa L chain [49010] (4 PDB entries)

8. Domain d1ncbl2: 1ncb L:109-214 [21036]
   Other proteins in same PDB: d1ncbh1, d1ncbl1, d1ncbn_

Details for d1ncbl2

PDB Entry: 1ncb, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbl2:

Sequence; same for both SEQRES and ATOM records:

>d1ncbl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ncbl2:

• d1ncbl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ncbl2 appears in SCOP 1.59
  
• d1ncbl2 appears in SCOP 1.63
  
• d1ncbl2 appears in the current release, SCOPe 2.08