Lineage for d3g4fa1 (3g4f A:25-226)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277308Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1277309Protein automated matches [226931] (6 species)
    not a true protein
  7. 1277313Species Gossypium arboreum [TaxId:29729] [225678] (2 PDB entries)
  8. 1277316Domain d3g4fa1: 3g4f A:25-226 [210355]
    Other proteins in same PDB: d3g4fa2, d3g4fb2
    automated match to d1hxga1
    complexed with bme, fpf, mg

Details for d3g4fa1

PDB Entry: 3g4f (more details), 2.65 Å

PDB Description: Crystal Structure of (+)- -Cadinene Synthase from Gossypium arboreum in complex with 2-fluorofarnesyl diphosphate
PDB Compounds: (A:) (+)-delta-cadinene synthase isozyme XC1

SCOPe Domain Sequences for d3g4fa1:

Sequence, based on SEQRES records: (download)

>d3g4fa1 a.102.4.0 (A:25-226) automated matches {Gossypium arboreum [TaxId: 29729]}
adfqpsiwgdlflncpdknidaetekrhqqlkeevrkmivapmanstqklafidsvqrlg
vsyhftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfk
ssvtsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqs
irrglprvearhylsvyqdies

Sequence, based on observed residues (ATOM records): (download)

>d3g4fa1 a.102.4.0 (A:25-226) automated matches {Gossypium arboreum [TaxId: 29729]}
adfqpsiwgdlflncpddaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
glprvearhylsvyqdes

SCOPe Domain Coordinates for d3g4fa1:

Click to download the PDB-style file with coordinates for d3g4fa1.
(The format of our PDB-style files is described here.)

Timeline for d3g4fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g4fa2