Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
Protein automated matches [226931] (6 species) not a true protein |
Species Gossypium arboreum [TaxId:29729] [225678] (2 PDB entries) |
Domain d3g4db1: 3g4d B:28-226 [210353] Other proteins in same PDB: d3g4da2, d3g4db2 automated match to d1hxga1 complexed with bme, gol |
PDB Entry: 3g4d (more details), 2.4 Å
SCOPe Domain Sequences for d3g4db1:
Sequence, based on SEQRES records: (download)
>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]} qpsiwgdlflncpdknidaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr glprvearhylsvyqdies
>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]} qpsiwgdlflncpdkniaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsyh ftkeiedeleniyhnndlyttsirfrllrehgynvscdvfnkfkdeqgnfkssvtsdvrg llelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirrglprve arhylsvyqdies
Timeline for d3g4db1: