Lineage for d2jelh2 (2jel H:114-226)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221566Species Fab JE142 (mouse), kappa L chain [49009] (1 PDB entry)
  8. 221567Domain d2jelh2: 2jel H:114-226 [21035]
    Other proteins in same PDB: d2jelh1, d2jell1, d2jelp_
    complexed with so4

Details for d2jelh2

PDB Entry: 2jel (more details), 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jelh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jelh2 b.1.1.2 (H:114-226) Immunoglobulin (constant domains of L and H chains) {Fab JE142 (mouse), kappa L chain}
aattppsvyplapgsggqgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlaad
lytlsssvtvpssprpsetvtcnvahpasstkvdkkiapg

SCOP Domain Coordinates for d2jelh2:

Click to download the PDB-style file with coordinates for d2jelh2.
(The format of our PDB-style files is described here.)

Timeline for d2jelh2: