SCOP 1.57: Domain d2jelh2: 2jel H:114-226

Lineage for d2jelh2 (2jel H:114-226)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab JE142 (mouse), kappa L chain [49009] (1 PDB entry)

8. Domain d2jelh2: 2jel H:114-226 [21035]
   Other proteins in same PDB: d2jelh1, d2jell1, d2jelp_

Details for d2jelh2

PDB Entry: 2jel, 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jelh2:

Sequence; same for both SEQRES and ATOM records:

>d2jelh2 b.1.1.2 (H:114-226) Immunoglobulin (constant domains of L and H chains) {Fab JE142 (mouse), kappa L chain}
aattppsvyplapgsggqgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlaad
lytlsssvtvpssprpsetvtcnvahpasstkvdkkiapg

Timeline for d2jelh2:

• d2jelh2 first appeared (with stable ids) in SCOP 1.55
  
• d2jelh2 appears in SCOP 1.59
  
• d2jelh2 appears in the current release, SCOPe 2.08