Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
Domain d2jell2: 2jel L:109-212 [21034] Other proteins in same PDB: d2jelh1, d2jelh2, d2jell1, d2jelp_ part of Fab JE142 complexed with so4 |
PDB Entry: 2jel (more details), 2.5 Å
SCOP Domain Sequences for d2jell2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jell2 b.1.1.2 (L:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkigdgarqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktsdspivksfnrn
Timeline for d2jell2: