Lineage for d3hfmh2 (3hfm H:114-215)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104252Species Fab HyHEL-10 (mouse), kappa L chain [49008] (1 PDB entry)
  8. 104253Domain d3hfmh2: 3hfm H:114-215 [21033]
    Other proteins in same PDB: d3hfmh1, d3hfml1, d3hfmy_

Details for d3hfmh2

PDB Entry: 3hfm (more details), 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfmh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfmh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d3hfmh2:

Click to download the PDB-style file with coordinates for d3hfmh2.
(The format of our PDB-style files is described here.)

Timeline for d3hfmh2: