Lineage for d3hfml2 (3hfm L:109-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656504Domain d3hfml2: 3hfm L:109-214 [21032]
    Other proteins in same PDB: d3hfmh1, d3hfmh2, d3hfml1, d3hfmy_
    part of Fab HyHEL-10

Details for d3hfml2

PDB Entry: 3hfm (more details), 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex
PDB Compounds: (L:) hyhel-10 igg1 fab (light chain)

SCOP Domain Sequences for d3hfml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfml2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d3hfml2:

Click to download the PDB-style file with coordinates for d3hfml2.
(The format of our PDB-style files is described here.)

Timeline for d3hfml2: