SCOPe 2.08: Domain d3g25c2: 3g25 C:253-498

Lineage for d3g25c2 (3g25 C:253-498)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries)

8. Domain d3g25c2: 3g25 C:253-498 [210319]
   Other proteins in same PDB: d3g25a3, d3g25b3, d3g25d3
   automated match to d3ezwd2
   complexed with gol, na, po4

Details for d3g25c2

PDB Entry: 3g25, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with glycerol.

PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d3g25c2:

Sequence; same for both SEQRES and ATOM records:

>d3g25c2 c.55.1.0 (C:253-498) automated matches {Staphylococcus aureus [TaxId: 93062]}
acfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvnyalegsifvsgsai
qwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdseargaifgltrgtek
ehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimqfqadivntsverp
eiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegereklyrgwkkaveat
qvfkte

Timeline for d3g25c2:

• d3g25c2 first appeared in SCOPe 2.03
  
• d3g25c2 appears in SCOPe 2.07