SCOPe 2.06: Domain d3g1ib_: 3g1i B:

Lineage for d3g1ib_ (3g1i B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (4 species)
   not a true protein

7. Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries)

8. Domain d3g1ib_: 3g1i B: [210310]
   automated match to d1eoqa_
   complexed with so4

Details for d3g1ib_

PDB Entry: 3g1i, 2.1 Å

PDB Description: Crystal structure of the C-terminal domain of the Rous Sarcoma Virus capsid protein: Intermediate pH

PDB Compounds: (B:) gag polyprotein

SCOPe Domain Sequences for d3g1ib_:

Sequence; same for both SEQRES and ATOM records:

>d3g1ib_ a.28.3.1 (B:) automated matches {Rous sarcoma virus [TaxId: 11888]}
pwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtapst
lttpgeiikyvldrq

Timeline for d3g1ib_:

• d3g1ib_ first appeared in SCOPe 2.03
  
• d3g1ib_ appears in SCOPe 2.05
  
• d3g1ib_ appears in SCOPe 2.07
  
• d3g1ib_ appears in the current release, SCOPe 2.08