| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
| Domain d2iffh2: 2iff H:117-215 [21031] Other proteins in same PDB: d2iffh1, d2iffl1, d2iffl2, d2iffy_ part of Fab HyHEL-5 mutant |
PDB Entry: 2iff (more details), 2.65 Å
SCOP Domain Sequences for d2iffh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iffh2 b.1.1.2 (H:117-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
Timeline for d2iffh2: