SCOP 1.57: Domain d2iffh2: 2iff H:117-215

Lineage for d2iffh2 (2iff H:117-215)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)

8. Domain d2iffh2: 2iff H:117-215 [21031]
   Other proteins in same PDB: d2iffh1, d2iffl1, d2iffy_

Details for d2iffh2

PDB Entry: 2iff, 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

SCOP Domain Sequences for d2iffh2:

Sequence; same for both SEQRES and ATOM records:

>d2iffh2 b.1.1.2 (H:117-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d2iffh2:

• d2iffh2 first appeared (with stable ids) in SCOP 1.55
  
• d2iffh2 appears in SCOP 1.59
  
• d2iffh2 appears in the current release, SCOPe 2.07