Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries) |
Domain d2iffl2: 2iff L:107-212 [21030] Other proteins in same PDB: d2iffh1, d2iffl1, d2iffy_ |
PDB Entry: 2iff (more details), 2.65 Å
SCOP Domain Sequences for d2iffl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iffl2 b.1.1.2 (L:107-212) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2iffl2: