Lineage for d1bqlh2 (1bql H:117-215)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221556Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)
  8. 221557Domain d1bqlh2: 1bql H:117-215 [21029]
    Other proteins in same PDB: d1bqlh1, d1bqll1, d1bqly_

Details for d1bqlh2

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqlh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqlh2 b.1.1.2 (H:117-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1bqlh2:

Click to download the PDB-style file with coordinates for d1bqlh2.
(The format of our PDB-style files is described here.)

Timeline for d1bqlh2: