SCOP 1.59: Domain d1bqlh2: 1bql H:117-215

Lineage for d1bqlh2 (1bql H:117-215)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)

8. Domain d1bqlh2: 1bql H:117-215 [21029]
   Other proteins in same PDB: d1bqlh1, d1bqll1, d1bqly_

Details for d1bqlh2

PDB Entry: 1bql, 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqlh2:

Sequence; same for both SEQRES and ATOM records:

>d1bqlh2 b.1.1.2 (H:117-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1bqlh2:

• d1bqlh2 first appeared (with stable ids) in SCOP 1.55
  
• d1bqlh2 appears in SCOP 1.57
  
• d1bqlh2 appears in SCOP 1.61
  
• d1bqlh2 appears in the current release, SCOPe 2.08