Lineage for d1bqll2 (1bql L:107-212)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8990Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)
  8. 8992Domain d1bqll2: 1bql L:107-212 [21028]
    Other proteins in same PDB: d1bqlh1, d1bqll1, d1bqly_

Details for d1bqll2

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqll2 b.1.1.2 (L:107-212) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1bqll2:

Click to download the PDB-style file with coordinates for d1bqll2.
(The format of our PDB-style files is described here.)

Timeline for d1bqll2: