SCOP 1.55: Domain d1cicb2: 1cic B:118-217

Lineage for d1cicb2 (1cic B:118-217)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [49006] (1 PDB entry)

8. Domain d1cicb2: 1cic B:118-217 [21025]
   Other proteins in same PDB: d1cica1, d1cicb1, d1cicc1, d1cicd1

Details for d1cicb2

PDB Entry: 1cic, 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicb2:

Sequence; same for both SEQRES and ATOM records:

>d1cicb2 b.1.1.2 (B:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain}
alttppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsetvtcsvahpassttvdkkleps

Timeline for d1cicb2:

• d1cicb2 appears in SCOP 1.57
  
• d1cicb2 appears in the current release, SCOPe 2.08