Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [49006] (1 PDB entry) |
Domain d1cicb2: 1cic B:118-217 [21025] Other proteins in same PDB: d1cica1, d1cicb1, d1cicc1, d1cicd1 |
PDB Entry: 1cic (more details), 2.5 Å
SCOP Domain Sequences for d1cicb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cicb2 b.1.1.2 (B:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain} alttppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqsg lytmsssvtvpsstwpsetvtcsvahpassttvdkkleps
Timeline for d1cicb2: