Lineage for d3fweb2 (3fwe B:138-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694708Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)
  8. 2694734Domain d3fweb2: 3fwe B:138-208 [210242]
    Other proteins in same PDB: d3fwea1, d3fweb1
    automated match to d1i5za1
    complexed with pro; mutant

Details for d3fweb2

PDB Entry: 3fwe (more details), 2.3 Å

PDB Description: crystal structure of the apo d138l cap mutant
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3fweb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fweb2 a.4.5.0 (B:138-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

SCOPe Domain Coordinates for d3fweb2:

Click to download the PDB-style file with coordinates for d3fweb2.
(The format of our PDB-style files is described here.)

Timeline for d3fweb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fweb1