Lineage for d1cica2 (1cic A:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656307Domain d1cica2: 1cic A:108-214 [21024]
    Other proteins in same PDB: d1cica1, d1cicb1, d1cicb2, d1cicc1, d1cicd1, d1cicd2
    part of D1.3 anti-idiotope Fab E225

Details for d1cica2

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225
PDB Compounds: (A:) protein (ig heavy chain v regions)

SCOP Domain Sequences for d1cica2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cica2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cica2:

Click to download the PDB-style file with coordinates for d1cica2.
(The format of our PDB-style files is described here.)

Timeline for d1cica2: