Lineage for d1cica2 (1cic A:108-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8505Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [49006] (1 PDB entry)
  8. 8506Domain d1cica2: 1cic A:108-214 [21024]
    Other proteins in same PDB: d1cica1, d1cicb1, d1cicc1, d1cicd1

Details for d1cica2

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cica2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cica2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cica2:

Click to download the PDB-style file with coordinates for d1cica2.
(The format of our PDB-style files is described here.)

Timeline for d1cica2: