SCOPe 2.03: Domain d3fwea1: 3fwe A:6-137

Lineage for d3fwea1 (3fwe A:6-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (28 PDB entries)

8. Domain d3fwea1: 3fwe A:6-137 [210239]
   Other proteins in same PDB: d3fwea2, d3fweb2
   automated match to d1g6na2
   complexed with pro; mutant

Details for d3fwea1

PDB Entry: 3fwe, 2.3 Å

PDB Description: crystal structure of the apo d138l cap mutant

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d3fwea1:

Sequence; same for both SEQRES and ATOM records:

>d3fwea1 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
qtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyln
qgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlq
vtsekvgnlafl

Timeline for d3fwea1:

• d3fwea1 is new in SCOPe 2.03-stable
  
• d3fwea1 appears in SCOPe 2.04
  
• d3fwea1 appears in the current release, SCOPe 2.08