SCOPe 2.03: Domain d3fv9h1: 3fv9 H:1-127

Lineage for d3fv9h1 (3fv9 H:1-127)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225250] (4 PDB entries)

8. Domain d3fv9h1: 3fv9 H:1-127 [210214]
   Other proteins in same PDB: d3fv9a2, d3fv9b2, d3fv9c2, d3fv9d2, d3fv9e2, d3fv9f2, d3fv9g2, d3fv9h2
   automated match to d1jpma2
   complexed with mg

Details for d3fv9h1

PDB Entry: 3fv9, 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium

PDB Compounds: (H:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9h1:

Sequence; same for both SEQRES and ATOM records:

>d3fv9h1 d.54.1.0 (H:1-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
lcdmtgg

Timeline for d3fv9h1:

• d3fv9h1 is new in SCOPe 2.03-stable
  
• d3fv9h1 appears in SCOPe 2.04
  
• d3fv9h1 appears in the current release, SCOPe 2.08