Lineage for d3fv9g1 (3fv9 G:1-127)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905749Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 1905756Domain d3fv9g1: 3fv9 G:1-127 [210212]
    Other proteins in same PDB: d3fv9a2, d3fv9b2, d3fv9c2, d3fv9d2, d3fv9e2, d3fv9f2, d3fv9g2, d3fv9h2
    automated match to d1jpma2
    complexed with mg

Details for d3fv9g1

PDB Entry: 3fv9 (more details), 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv9g1 d.54.1.0 (G:1-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
lcdmtgg

SCOPe Domain Coordinates for d3fv9g1:

Click to download the PDB-style file with coordinates for d3fv9g1.
(The format of our PDB-style files is described here.)

Timeline for d3fv9g1: