Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries) |
Domain d3fv9f2: 3fv9 F:128-373 [210211] Other proteins in same PDB: d3fv9a1, d3fv9b1, d3fv9c1, d3fv9d1, d3fv9e1, d3fv9f1, d3fv9g1, d3fv9h1 automated match to d1jpma1 complexed with mg |
PDB Entry: 3fv9 (more details), 1.9 Å
SCOPe Domain Sequences for d3fv9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fv9f2 c.1.11.0 (F:128-373) automated matches {Roseovarius nubinhibens [TaxId: 89187]} rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt pvktfg
Timeline for d3fv9f2: