SCOP 1.69: Domain d1fdlh2: 1fdl H:117-218

Lineage for d1fdlh2 (1fdl H:117-218)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1fdlh2: 1fdl H:117-218 [21021]
   Other proteins in same PDB: d1fdlh1, d1fdll1, d1fdll2, d1fdly_
   part of Fab D1.3

Details for d1fdlh2

PDB Entry: 1fdl, 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdlh2:

Sequence; same for both SEQRES and ATOM records:

>d1fdlh2 b.1.1.2 (H:117-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
asttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1fdlh2:

• d1fdlh2 first appeared (with stable ids) in SCOP 1.55
  
• d1fdlh2 appears in SCOP 1.67
  
• d1fdlh2 appears in SCOP 1.71
  
• d1fdlh2 appears in the current release, SCOPe 2.08