Lineage for d1fdlh2 (1fdl H:117-218)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159770Species Fab D1.3 (mouse), kappa L chain [49005] (2 PDB entries)
  8. 159771Domain d1fdlh2: 1fdl H:117-218 [21021]
    Other proteins in same PDB: d1fdlh1, d1fdll1, d1fdly_

Details for d1fdlh2

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdlh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdlh2 b.1.1.2 (H:117-218) Immunoglobulin (constant domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
asttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1fdlh2:

Click to download the PDB-style file with coordinates for d1fdlh2.
(The format of our PDB-style files is described here.)

Timeline for d1fdlh2: