SCOPe 2.03: Domain d3fv9b2: 3fv9 B:128-373

Lineage for d3fv9b2 (3fv9 B:128-373)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225251] (4 PDB entries)

8. Domain d3fv9b2: 3fv9 B:128-373 [210203]
   Other proteins in same PDB: d3fv9a1, d3fv9b1, d3fv9c1, d3fv9d1, d3fv9e1, d3fv9f1, d3fv9g1, d3fv9h1
   automated match to d1jpma1
   complexed with mg

Details for d3fv9b2

PDB Entry: 3fv9, 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9b2:

Sequence; same for both SEQRES and ATOM records:

>d3fv9b2 c.1.11.0 (B:128-373) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla
drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld
eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf
aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt
pvktfg

Timeline for d3fv9b2:

• d3fv9b2 is new in SCOPe 2.03-stable
  
• d3fv9b2 appears in SCOPe 2.04
  
• d3fv9b2 appears in the current release, SCOPe 2.08