SCOP 1.67: Domain d1fdll2: 1fdl L:108-214

Lineage for d1fdll2 (1fdl L:108-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1fdll2: 1fdl L:108-214 [21020]
   Other proteins in same PDB: d1fdlh1, d1fdlh2, d1fdll1, d1fdly_
   part of Fab D1.3

Details for d1fdll2

PDB Entry: 1fdl, 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdll2:

Sequence; same for both SEQRES and ATOM records:

>d1fdll2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1fdll2:

• d1fdll2 first appeared (with stable ids) in SCOP 1.55
  
• d1fdll2 appears in SCOP 1.65
  
• d1fdll2 appears in SCOP 1.69
  
• d1fdll2 appears in the current release, SCOPe 2.08