Lineage for d3fv5a_ (3fv5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974020Species Escherichia coli K-12 [TaxId:83333] [225819] (2 PDB entries)
  8. 2974021Domain d3fv5a_: 3fv5 A: [210195]
    automated match to d1aj6a_
    complexed with 1eu

Details for d3fv5a_

PDB Entry: 3fv5 (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV co-complexed with inhibitor
PDB Compounds: (A:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d3fv5a_:

Sequence, based on SEQRES records: (download)

>d3fv5a_ d.122.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrdg
qvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavl
cpgveitfkdeinnteqrwcy

Sequence, based on observed residues (ATOM records): (download)

>d3fv5a_ d.122.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlisvvnalskrvevnvrrdgqvyniafengekvqdlqvvgt
cgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwcy

SCOPe Domain Coordinates for d3fv5a_:

Click to download the PDB-style file with coordinates for d3fv5a_.
(The format of our PDB-style files is described here.)

Timeline for d3fv5a_: