SCOPe 2.05: Domain d1frgh2: 1frg H:337-437

Lineage for d1frgh2 (1frg H:337-437)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1frgh2: 1frg H:337-437 [21019]
   Other proteins in same PDB: d1frgh1, d1frgl1, d1frgl2
   part of Fab 26/9

Details for d1frgh2

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

PDB Compounds: (H:) igg2a 26/9 fab (heavy chain)

SCOPe Domain Sequences for d1frgh2:

Sequence; same for both SEQRES and ATOM records:

>d1frgh2 b.1.1.2 (H:337-437) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1frgh2:

• d1frgh2 first appeared (with stable ids) in SCOP 1.55
  
• d1frgh2 appears in SCOPe 2.04
  
• d1frgh2 appears in SCOPe 2.06
  
• d1frgh2 appears in the current release, SCOPe 2.08