SCOP 1.55: Domain d1frgh2: 1frg H:337-437

Lineage for d1frgh2 (1frg H:337-437)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 26/9 (mouse), kappa L chain [49004] (1 PDB entry)

8. Domain d1frgh2: 1frg H:337-437 [21019]
   Other proteins in same PDB: d1frgh1, d1frgl1

Details for d1frgh2

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgh2:

Sequence; same for both SEQRES and ATOM records:

>d1frgh2 b.1.1.2 (H:337-437) Immunoglobulin (constant domains of L and H chains) {Fab 26/9 (mouse), kappa L chain}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1frgh2:

• d1frgh2 appears in SCOP 1.57
  
• d1frgh2 appears in the current release, SCOPe 2.08